.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gmq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein EF0006 from Enterococcus faecalis. To be Published
    Site MCSG
    PDB Id 2gmq Target Id APC28809
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5420,AAO80338, 226185 Molecular Weight 13623.32 Da.
    Residues 118 Isoelectric Point 9.36
    Sequence meavvvereakgmkeiaiqekdltlqwrgntgklvkvrlkntramemwynkqiteeniqeittlniikn gkslalevypeksiyvkpnlgrinvpvffiktpinrgvfeeifgetlka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.76 Rfree 0.21663
    Matthews' coefficent 2.63 Rfactor 0.1906
    Waters 177 Solvent Content 53.20

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch