.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gnp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a transcriptional regulator from Streptococcus pneumoniae TIGR4. To be Published
    Site MCSG
    PDB Id 2gnp Target Id APC84799
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5746,AAK74426.1, PF04198, 170187 Molecular Weight 29919.54 Da.
    Residues 263 Isoelectric Point 5.53
    Sequence nfdtnmfklenyvkekyslesleiipnefddtptilserisqvaagvlrnliddnmkigfswgkslsnl vdlihsksvrnvhfyplaggpshihakyhvntliyemsrkfhgectfmnativqenklladgilqsryf enlknswkdldiavvgigdfsnkgkhqwldmlteddfkeltkvktvgeiccrffdskgkevyenlqert iaisledlknipqslavaygdtkvssilsvlranlvnhlitdkntilkvleedgdl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.23677
    Matthews' coefficent 2.08 Rfactor 0.19335
    Waters 282 Solvent Content 40.79

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals

    Jmol

     
    Google Scholar output for 2gnp
    1. A phospho_sugar binding domain homologous to NagB enzymes regulates the activity of the central glycolytic genes repressor
    T Doan, L Martin, S Zorrilla, D Chaix - Proteins: Structure, , 2008 - Wiley Online Library
     
    2. Crystal structures of the effector_binding domain of repressor Central glycolytic gene Regulator from Bacillus subtilis reveal ligand_induced structural changes upon
    P _ez_ov, M Koek, SF Moy - Molecular , 2008 - Wiley Online Library
     
    3. Crystal structure of the full-length sorbitol operon regulator SorC from Klebsiella pneumoniae: structural evidence for a novel transcriptional regulation mechanism
    D de Sanctis, CE McVey, FJ Enguita - Journal of molecular , 2009 - Elsevier
     
    4. Overexpression, purification and crystallization of the tetrameric form of SorC sorbitol operon regulator
    D De Sanctis, AT Rgo, D Maral - Section F: Structural , 2007 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch