.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gs5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.5A crystal structure of a conserved hypothetical protein from Corvnebacterium diphtheriae. To be Published
    Site MCSG
    PDB Id 2gs5 Target Id APC82954
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS5697,CAE50889.1, 1717 Molecular Weight 21371.27 Da.
    Residues 198 Isoelectric Point 4.48
    Sequence mfadrlfnamernepapgmvlvaapsmesedfarsviliiehseyatfgvnlasrsdvavfnvipewvp cvtkpqalyiggplnqqsvvgvgvtaqgvdaarvdnltrlanrlvmvnlgadpeeikplvsgmrlfagh aewapgqlaqeiengdwfvapalpsdvtapgsvdvwgdvmrrqpmplplystfpvnvgen
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.21024
    Matthews' coefficent 2.24 Rfactor 0.18357
    Waters 257 Solvent Content 45.19

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch