.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gs8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of mevalonate pyrophosphate decarboxylase from Streptococcus pyogenes. To be Published
    Site MCSG
    PDB Id 2gs8 Target Id APC29850
    Molecular Characteristics
    Source Streptococcus pyogenes m1 gas
    Alias Ids TPS5482,AAK33797, 160490 Molecular Weight 34753.75 Da.
    Residues 314 Isoelectric Point 6.00
    Sequence mdpnvitvtsyaniaiikywgkenqakmipstssisltlenmftttsvsflpdtatsdqfyingilqnd eehtkisaiidqfrqpgqafvkmetqnnmptaaglsssssglsalvkacdqlfdtqldqkalaqkakfa sgsssrsffgpvaawdkdsgaiykvetdlkmamimlvlnaakkpissregmklcrdtsttfdqwveqsa idyqhmltylktnnfekvgqlteanalamhattktanppfsyltkesyqameavkelrqegfacyftmd agpnvkvlclekdlaqlaerlgknyriivsktkdlpdv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.19363
    Matthews' coefficent 1.97 Rfactor 0.16509
    Waters 494 Solvent Content 37.49

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 9;ACY (ACETIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 2gs8
    1. Probing ligand-binding pockets of the mevalonate pathway enzymes from Streptococcus pneumoniae
    ST Lefurgy, SB Rodriguez, CS Park, S Cahill - Journal of Biological , 2010 - ASBMB
     
    2. Crystal structures of staphylococcus epidermidis mevalonate diphosphate decarboxylase bound to inhibitory analogs reveal new insight into substrate binding and
    ML Barta, DA Skaff, WJ McWhorter - Journal of Biological , 2011 - ASBMB
     
    3. Backbone 1 H, 13 C, 15 N NMR assignments of the unliganded and substrate ternary complex forms of mevalonate diphosphate decarboxylase from Streptococcus
    G Reuther, R Harris, M Girvin, TS Leyh - Biomolecular NMR Assignments, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch