.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gtq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of aminopeptidase N from human pathogen Neisseria meningitidis. Proteins 70 273-279 2007
    Site MCSG
    PDB Id 2gtq Target Id APC84138
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS5733,AAF41777.1, 122586 Molecular Weight 97675.40 Da.
    Residues 867 Isoelectric Point 5.42
    Sequence msktvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsvkingaaady vlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepegfrkitfyidrpdvmskft ttivadkkrypvllsngnkidggefsdgrhwvkwedpfskpsylfalvagdlavtedyfttmsgrnvki efytteadkpkvgfaveslknamkwdetrfgleydldifmvvavgdfnmgamenkglnifntkfvlads rtatdtdfegiesvvgheyfhnwtgnrvtcrdwfqlslkegltvfrdqefsgdrasravrrienirllr qhqfpedagptahpvrpasyeemnnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtc ddfraamadanginldqfalwysqagtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkvgl lnrngeavafdyqgkrateavlllteaeqtfllegvteavvpsllrgfsapvhlnypysdddlllllah dsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvisddlldnafkalllgvpseaelw dgaenidplryhqarealldtlavhflpkwhelnrqaakqenqsyeyspeaagwrtlrnvcrafvlrad pahietvaekygemaqnmthewgilsavngnesdtrnrllaqfadkfsddalvmdkyfalvgssrrsdt lqqvrtalqhpkfslenpnkarsligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafn lcnklephrknlvkqalqriraqeglskdvgeivgkild
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.21143
    Matthews' coefficent 2.83 Rfactor 0.16397
    Waters 743 Solvent Content 56.48

    Ligand Information
    Ligands SO4 (SULFATE) x 16
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2gtq
    1. Structure of aminopeptidase N from Escherichia coli suggests a compartmentalized, gated active site
    A Addlagatta, L Gay - Proceedings of the , 2006 - National Acad Sciences
     
    2. Structural basis for the inhibition of the essential Plasmodium falciparum M1 neutral aminopeptidase
    S McGowan, CJ Porter, J Lowther - Proceedings of the , 2009 - National Acad Sciences
     
    3. Crystal structure of aminopeptidase N from human pathogen Neisseria meningitidis
    B Nocek, R Mulligan, M Bargassa - Proteins: Structure, , 2008 - Wiley Online Library
     
    4. Benefits of structural genomics for drug discovery research
    M Grabowski, M Chruszcz, MD Zimmerman - disorders drug targets, 2009 - ncbi.nlm.nih.gov
     
    5. Validity of Protein Structure Alignment Method Based on Backbone Torsion Angles
    S Jung, SE Bae, HS Son - J Proteomics Bioinform, 2011 - omicsonline.org
     
    6. Structural Bases of Coronavirus Attachment to Host Aminopeptidase N and Its Inhibition by Neutralizing Antibodies
    J Reguera, C Santiago, G Mudgal, D Ordoo - PLoS , 2012 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch