.
The Open Protein Structure Annotation Network
PDB Keyword
.

2guh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative TetR-family Transcriptional Regulator from Rhodococcus sp. RHA1. To be Published
    Site MCSG
    PDB Id 2guh Target Id APC5898
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS4910,RHA06424, 101510 Molecular Weight 20796.78 Da.
    Residues 190 Isoelectric Point 5.80
    Sequence vtsdpgtaapvkrtaeqsrslivdaagrafatrpyreitlkdiaedagvsapliikyfgskeqlfdalv dfraaaeivfsgpldglgermvsmfarplepykplslnilfmsgpseessrklranysaqmidalaerl pgrdarlraelvmsmltglavmrrkmmqehatgtpeevvahyaplvqelldg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.52 Rfree 0.18781
    Matthews' coefficent 2.12 Rfactor 0.1685
    Waters 450 Solvent Content 42.08

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 4
    Metals MG (MAGNESIUM) x 3

    Jmol

     
    Google Scholar output for 2guh
    1. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    2. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch