The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Conserved Hypothetical Protein from Porphyromonas gingivalis. To be Published
    Site MCSG
    PDB Id 2guk Target Id APC81122
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS5643,AAQ66846.1, 242619 Molecular Weight 13668.86 Da.
    Residues 117 Isoelectric Point 6.11
    Sequence mdtqtlnsdlrvfmhhiyefekgvrsmvlatlanddipyaeerlrsrqipyfaqptpntertnlffgck ecmeairlfvsgrslnsltpeedfiigamlgydicrqcerycrrksns
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.91 Rfree 0.28056
    Matthews' coefficent 2.06 Rfactor 0.23253
    Waters 132 Solvent Content 40.27

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch