.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gup

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a ROK family protein from Streptococcus pneumoniae TIGR4 in complex with sucrose. To be Published
    Site MCSG
    PDB Id 2gup Target Id APC80695
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5618,AAK76199, 170187 Molecular Weight 31419.71 Da.
    Residues 289 Isoelectric Point 4.62
    Sequence mtiatidiggtgikfasltpdgkildktsistpenledllawldqrlseqdysgiamsvpgavnqetgv idgfsavpyihgfswyealssyqlpvhlendancvglsellahpelenaacvvigtgiggamiingrlh rgrhglggefgymttlapaeklnnwsqlastgnmvryvieksghtdwdgrkiyqeaaagnilcqeaier mnrnlaqgllniqylidpgvislggsisqnpdfiqgvkkavedfvdayeeytvapviqactyhadanly galvnwlqeekqw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.01 Rfree 0.22823
    Matthews' coefficent 2.88 Rfactor 0.18464
    Waters 84 Solvent Content 57.31

    Ligand Information
    Ligands SUC (SUCROSE) x 3;TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2gup
    1. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch