.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gwn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of putative dihydroorotase from Porphyromonas gingivalis. To be Published
    Site MCSG
    PDB Id 2gwn Target Id APC80918
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS5632,AAQ66055.1, 242619 Molecular Weight 50014.17 Da.
    Residues 449 Isoelectric Point 5.99
    Sequence mkillrnalitnegktfpgsvmidgafisriiegelpaddnlsadeviecsglrlfpgciddqvhfrep glthkatiasesraavaggvtsfmdmpntnppttmwerllekrqigadtawanygfffggtndnideik rvdkhlvpglklflgsstgnmlvdnketlekifgecdlliathcekeeiirankehykakygndldihf hplirseeacyrssaeavelaermnarlhilhlstekelslfrndiptaqkritsevcvhhlwfsdtdy grlgnrikwnpaikkesdrealraavrngridiiatdhaphllrekegsclqaasggplvqhsllalle lcnqgifsieeivsktahipatlfaiekrgyirpgyyadlvlvdpssphtvsadnilslcgwspfegft fshsvaytfvngclayakgrlaesrptvhplffnr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.19372
    Matthews' coefficent 2.12 Rfactor 0.14875
    Waters 492 Solvent Content 41.98

    Ligand Information
    Ligands CAC (CACODYLATE) x 2;SO4 (SULFATE) x 5;BME (BETA-MERCAPTOETHANOL) x 2;GOL (GLYCEROL) x 2
    Metals ZN (ZINC) x 2;CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2gwn
    1. Dihydroorotase of human malarial parasite Plasmodium falciparum differs from host enzyme
    SR Krungkrai, N Wutipraditkul, J Krungkrai - Biochemical and biophysical , 2008 - Elsevier
     
    2. Structures of Ligand-free and Inhibitor Complexes of Dihydroorotase from Escherichia coli: Implications for Loop Movement in Inhibitor Design
    M Lee, CW Chan, SC Graham - Journal of molecular , 2007 - Elsevier
     
    3. Reversible post-translational carboxylation modulates the enzymatic activity of N-acetyl-L-ornithine transcarbamylase
    Y Li, X Yu, J Ho, D Fushman, N Allewell - Biochemistry, 2010 - ACS Publications
     
    4. Dihydroorotase Inhibitors
    M Lee, MJ Maher, RI Christopherson - Drug Design of Zinc_ , 2009 - Wiley Online Library
     
    5. Kinetic and structural analysis of mutant Escherichia coli dihydroorotases: a flexible loop stabilizes the transition state
    M Lee, MJ Maher, RI Christopherson, JM Guss - Biochemistry, 2007 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch