.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gx8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 2.2 A resolution crystal structure of Bacillus cereus Nif3-family protein YqfO reveals a conserved dimetal-binding motif and a regulatory domain. Protein Sci. 16 1285-1293 2007
    Site MCSG
    PDB Id 2gx8 Target Id APC26118
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5343,AAP11199, 226900 Molecular Weight 40848.95 Da.
    Residues 373 Isoelectric Point 5.98
    Sequence mskipngheiislfesmypkhlamegdkiglqigalnkpvrhvlialdvteevvdeaiqlganviiahh plifnplkaihtdkaygkiiekcikndiaiyaahtnvdvakggvndllaealglqntevlaptyaeemk kvvvfvpvthaeevrkalgdagaghignyshctfssegtgtfvpqegtnpyigetgqlerveevrieti ipaslqrkvikamvtahpyeevaydvypldnkgetlglgkigylqeemtlgqfaehvkqsldvkgarvv gklddkvrkvavlggdgnkyinqakfkgadvyvtgdmyyhvahdammlglnivdpghnvekvmkqgvqk qlqekvdakklnvhihasqlhtdpfifv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.20 Rfree 0.26123
    Matthews' coefficent 2.59 Rfactor 0.19572
    Waters 616 Solvent Content 52.60

    Ligand Information
    Ligands EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 5;TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 1
    Metals ZN (ZINC) x 6

    Jmol

     
    Google Scholar output for 2gx8
    1. The 2.2 resolution crystal structure of Bacillus cereus Nif3_family protein YqfO reveals a conserved dimetal_binding motif and a regulatory domain
    MH Godsey, G Minasov, L Shuvalova - Protein , 2007 - Wiley Online Library
     
    2. Structure of putative CutA1 from Homo sapiens determined at 2.05 A resolution
    B Bagautdinov, Y Matsuura, S Bagautdinova - Section F: Structural , 2008 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch