.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gz4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.5A crystal structure of a hypothetical protein Atu1052 from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2gz4 Target Id APC6005
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4974,NP_531749.1, 176299 Molecular Weight 22873.17 Da.
    Residues 207 Isoelectric Point 7.79
    Sequence mapaksprawqrmlsgrrldlldpspldveiadiahglarvarwngqtrgdhaftvaqhclivetifcr mcpgatpdemqmallhdapeyvigdmispfksvvgggyktvekrleaavhlrfglpphasrelkdrikk adtvaaffeatelagfstaeaqkffglprgitrdmfdiiplpsteaqrlfiarfeaietlrvtrtggav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.50 Rfree 0.18343
    Matthews' coefficent 2.25 Rfactor 0.15212
    Waters 1229 Solvent Content 45.31

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gz4
    1. Structural insight into the mechanism of substrate specificity and catalytic activity of an HD-domain phosphohydrolase: the 5'-deoxyribonucleotidase YfbR from
    MD Zimmerman, M Proudfoot, A Yakunin - Journal of molecular , 2008 - Elsevier
     
    2. Structure and activity of the Cas3 HD nuclease MJ0384, an effector enzyme of the CRISPR interference
    N Beloglazova, P Petit, R Flick, G Brown - The EMBO , 2011 - nature.com
     
    3. Refinement of protein termini in template_based modeling using conformational space annealing
    H Park, J Ko, K Joo, J Lee, C Seok - : Structure, Function, and , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch