.
The Open Protein Structure Annotation Network
PDB Keyword
.

2h0u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of NAD(P)H-flavin oxidoreductase from Helicobacter pylori. To be Published
    Site MCSG
    PDB Id 2h0u Target Id APC5874
    Molecular Characteristics
    Source Helicobacter pylori 26695
    Alias Ids TPS4890,NP_207436.1, 85962 Molecular Weight 25291.82 Da.
    Residues 217 Isoelectric Point 6.36
    Sequence mdreqvvalqhqrfaakkydpnrrisqkdwealvevgrlapssiglepwkmlllknermkedlkpmawg alfglegashfviylarkgvtydsdyvkkvmhevkkrdydtnsrfaqiiknfqendmklnserslfdwa skqtyiqmanmmmaaamlgidscpiegydqekveayleekgylntaefgvsvmacfgyrnqeitpktrw kteviyevie
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.22054
    Matthews' coefficent 2.16 Rfactor 0.17771
    Waters 216 Solvent Content 43.05

    Ligand Information
    Ligands FMN (FLAVIN) x 1
    Metals

    Jmol

     
    Google Scholar output for 2h0u
    1. Crystal Structure of a Minimal Nitroreductase, ydjA, from Escherichia coli K12 with and without FMN Cofactor
    JW Choi, J Lee, K Nishi, YS Kim, CH Jung - Journal of molecular , 2008 - Elsevier
     
    2. Crystal Structure of a Minimal Nitroreductase
    CH Jung, JS Kim - J. Mol. Biol, 2008 - ws.ajou.ac.kr
     
    3. STRUCTURAL AND FUNCTIONAL STUDIES ON THE HELICOBACTER PYLORI PROTEOME: THE STATE OF THE ART
    G Zanotti, L Cendron - Functional Proteomics & Nanotechnology- , 2010 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch