.
The Open Protein Structure Annotation Network
PDB Keyword
.

2h1i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Bacillus cereus Carboxylesterase. To be Published
    Site MCSG
    PDB Id 2h1i Target Id APC26065
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5341,AAP10572, 226900 Molecular Weight 22528.50 Da.
    Residues 202 Isoelectric Point 5.53
    Sequence mmkhvfqkgkdtskpvllllhgtggneldllplaeivdseasvlsvrgnvlengmprffrrlaegifde edlifrtkelnefldeaakeykfdrnnivaigysnganiaasllfhyenalkgavlhhpmvprrgmqla nlagksvfiaagtndpicssaeseelkvllenananvtmhwenrghqltmgevekakewydkaf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.80 Rfree 0.22977
    Matthews' coefficent 2.98 Rfactor 0.1671
    Waters 193 Solvent Content 58.70

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 5;ZN (ZINC) x 3;CA (CALCIUM) x 4

    Jmol

     
    Google Scholar output for 2h1i
    1. Molecular Healing of Polymeric Materials, Coatings, Plastics, Elastomers, Composites, Laminates, Adhesives, and Sealants by Active Enzymes
    CS McDaniel, ME Wales, J Rawlins, P Cipi - US Patent App. 12/ , 2010 - Google Patents
     
    2. Characterization of a novel thermostable carboxylesterase from Geobacillus kaustophilus HTA426 shows the existence of a new carboxylesterase family
    S Montoro-Garca, I Martnez-Martnez - Journal of , 2009 - Am Soc Microbiol
     
    3. FRET-based assay to monitor DNA binding and annealing by RAD52 recombination mediator protein
    JM Grimme, M Spies - Methods Mol Biol, 2011 - Springer
     
    4. Insights into the fatty acid chain length specificity of the carboxylesterase PA3859 from Pseudomonas aeruginosa: A combined structural, biochemical and
    A Pesaresi, D Lamba - Biochimie, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch