.
The Open Protein Structure Annotation Network
PDB Keyword
.

2h1n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Time-Controlled Microfluidic Seeding in nL-Volume Droplets To Separate Nucleation and Growth Stages of Protein Crystallization. Angew.Chem.Int.Ed.Engl. 45 8156-8160 2006
    Site MCSG
    PDB Id 2h1n Target Id APC36224
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5543,RBSTP0564, 1422 Molecular Weight 65978.86 Da.
    Residues 564 Isoelectric Point 5.33
    Sequence mkfsefryerpdiaqlqasfqealdsfrragsaalqheamkrinelrrrystmanlchirhtidtndef ykkeqdffdetepvvkglvndyyralvsspfraeleqvwgkqlfalaetqlktyapvivedlqkenkla seytkliasakimfegeertlaqlqpfvespdramrqrasearfsffkdyekeldelydelvhvrtaia rklgfqnfvelgyarlgrtdynadmvagyrrqvkthivplaaklrerqrqriqveklyyydepfmfptg nptpkgdadwivqngrqmyeelspetgeffrymvehelmdlvakkgkagggyctyiddykapfifsnft gtsgdidvltheaghafqvyesrhydipeynwptleaceihsmsmefftwpwmelffgedadkyrfahl sdallflpygvavdefqhavyenpdmtpaerksvwrniekaylptrdyadhdylerggfwqrqghiytd pfyyidytlaqvcafqfwkraqedrasawrdyvalcrlggsrpftelvksanlqspfadgavasvvghi erwldsvddkal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.00 Rfree 0.211
    Matthews' coefficent 3.87 Rfactor 0.185
    Waters 6 Solvent Content 68.24

    Ligand Information
    Ligands UNL (UNKNOWN) x 6
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2h1n
    1. Time_Controlled Microfluidic Seeding in nL_Volume Droplets To Separate Nucleation and Growth Stages of Protein Crystallization
    CJ Gerdts, V Tereshko, MK Yadav - Angewandte Chemie , 2006 - Wiley Online Library
     
    2. Crystallization and preliminary X-ray crystallographic studies of Pz peptidase A from Geobacillus collagenovorans MO-1
    A Kawasaki, H Nakano, Y Tsujimoto - Section F: Structural , 2007 - scripts.iucr.org
     
    3. Time-Controlled Microfluidic Seeding in nL Droplets to Separate Nucleation and Growth Stages of Protein Crystallization
    CJ Gerdts, V Tereshko, MK Yadav, I Dementieva - 2006 - ismagilovlab.che.caltech.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch