.
The Open Protein Structure Annotation Network
PDB Keyword
.

2h5n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein PG_1108 from Porphyromonas gingivalis W83. To be Published
    Site MCSG
    PDB Id 2h5n Target Id APC80971
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS5634,AAQ66219.1, 242619 Molecular Weight 14621.39 Da.
    Residues 133 Isoelectric Point 4.78
    Sequence mglgrqslnimtfsgqeltaiikmaksmvmadgkikpaeiavmtrefmrfgilqdqvdlllkasdsiea sqavaliarmdeerkkyvasylgvimasdgdiddnelalwtlistlcglptmtvmeainnmknl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.01 Rfree 0.24365
    Matthews' coefficent 2.38 Rfactor 0.18825
    Waters 331 Solvent Content 48.38

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 3

    Jmol

     
    Google Scholar output for 2h5n
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Guiding conformation space search with an all_atom energy potential
    TJ Brunette, O Brock - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    3. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    4. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    5. The Fragment-based Consistency Score in Model Quality Assessment for De Novo Prediction of Protein Structures
    H Cetin, TN Sasaki, M Sasai - Chem-Bio Informatics Journal, 2011 - J-STAGE
     
    6. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    7. ___________________________________
    H Cetin_ _____ ____ - CBI _____, 2011 - J-STAGE
     
    8. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch