.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ha9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein SP0239 from Streptococcus pneumoniae. To be Published
    Site MCSG
    PDB Id 2ha9 Target Id APC80209
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5589,AAK74419, 170187 Molecular Weight 46350.98 Da.
    Residues 445 Isoelectric Point 4.82
    Sequence mdirqvtetiamieeqnfdirtitmgislldcidpdinraaekiyqkittkaanlvavgdeiaaelgip ivnkrvsvtpisligaatdatdyvvlakaldkaakeigvdfiggfsalvqkgyqkgdeilinsiprala etdkvcssvnigstksginmtavadmgriiketanlsdmgvaklvvfanavednpfmagafhgvgeadv iinvgvsgpgvvkralekvrgqsfdvvaetvkktafkitrigqlvgqmaserlgvefgivdlslaptpa vgdsvarvleemgletvgthgttaalallndqvkkggvmacnqvgglsgafipvsedegmiaavqngsl nlekleamtaicsvgldmiaipedtpaetiaamiadeaaigvinmkttavriipkgkegdmiefggllg tapvmkvngassvdfisrggqipapihsfkn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.27127
    Matthews' coefficent 3.30 Rfactor 0.19376
    Waters 54 Solvent Content 62.76

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ha9
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Novel identification of expressed genes and functional classification of hypothetical proteins from Neisseria meningitidis serogroup A
    G Bernardini, S Arena, D Braconi, A Scaloni - , 2007 - Wiley Online Library
     
    3. The Fragment-based Consistency Score in Model Quality Assessment for De Novo Prediction of Protein Structures
    H Cetin, TN Sasaki, M Sasai - Chem-Bio Informatics Journal, 2011 - J-STAGE
     
    4. ___________________________________
    H Cetin_ _____ ____ - CBI _____, 2011 - J-STAGE
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch