.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hly

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of genomics APC5867. TO BE PUBLISHED
    Site MCSG
    PDB Id 2hly Target Id APC5867
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4884,NP_532972.1, 176299 Molecular Weight 22194.01 Da.
    Residues 202 Isoelectric Point 6.41
    Sequence mlikqtdyfriyrvinsllisqnadpasasmyfstfgafilqqhykvkavpkgglaaynlggtvllfad hredgyvtgagenfhcwveadgwaidfmapafsegtdalavpakmfqrplsamaasindlgqsgdffyr sepeatarrfadwhkqamigdmasvaanwfrkspkqmaaslsvtdrdgkartvpltgemltgaw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.21352
    Matthews' coefficent 2.00 Rfactor 0.17313
    Waters 279 Solvent Content 38.65

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hly
    1. Towards High-resolution Computational Approaches for Structure-based Drug Discovery
    J Li - 2011 - academiccommons.columbia.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch