.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hng

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of Hypothetical Protein SP_1558 from Streptococcus pneumoniae. To be Published 2006
    Site MCSG
    PDB Id 2hng Target Id APC84805
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5747,AAK75645.1, PF06619, 170187 Molecular Weight 14412.50 Da.
    Residues 124 Isoelectric Point 4.39
    Sequence mnlkreqefvsqyhfdarnfewenengapetkvdvnfqllqhdqenqvtslivilsfmivfdkfvisgt isqvnhidgrivnepselnqeevetlarpclnmlnrltyevteialdlpginlef
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.63 Rfree 0.23122
    Matthews' coefficent 2.23 Rfactor 0.18887
    Waters 170 Solvent Content 44.94

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hng
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    3. Structural fragments in protein model refinement
    SM Hollup, WR Taylor - Protein and Peptide Letters, 2008 - ingentaconnect.com
     
    4. Geometry, thermodynamics, and protein
    Y Fang, J Jing - Journal of theoretical biology, 2010 - Elsevier
     
    5. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    6. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch