.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ho5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Oxidoreductase, Gfo/Idh/MocA family from Streptococcus pneumoniae. To be Published
    Site MCSG
    PDB Id 2ho5 Target Id APC80523
    Related PDB Ids 2ho3 
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5609,AAK75576, 170187 Molecular Weight 36372.22 Da.
    Residues 325 Isoelectric Point 5.77
    Sequence mlklgvigtgaishhfieaahtsgeyqlvaiysrkletaatfasryqniqlfdqlevffkssfdlvyia spnslhfaqakaalsagkhvilekpavsqpqewfdliqtaeknncfifeaarnyhekafttiknfladk qvlgadfnyakysskmpdllagqtpnvfsdrfaggalmdlgiyplyaavrlfgkandatyhaqqldnsi dlngdgilfypdyqvhikagknitsnlpceiyttdgtltlntiehirsaiftdhqgnqvqlpiqqapht mteevaafahmiqqpdlnlyqtwlydagsvhellytmrqtagirfeaek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.56 Rfree 0.26627
    Matthews' coefficent 2.40 Rfactor 0.21085
    Waters 13 Solvent Content 48.83

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ho5
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Enhanced crystal packing due to solvent reorganization through reductive methylation of lysine residues in oxidoreductase from Streptococcus pneumoniae
    Y Fan, A Joachimiak - Journal of structural and functional genomics, 2010 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    2ho3.png
    No description
    48.62 kB22:13, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch