.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hsj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a putative platelet activating factor from Streptococcus pneumonia. To be Published
    Site MCSG
    PDB Id 2hsj Target Id APC80509
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5607,AAK75544, 170187 Molecular Weight 24115.27 Da.
    Residues 211 Isoelectric Point 4.94
    Sequence mavqllenwllkeqekiqtkyrhlnhisvvepnilfigdsiveyyplqelfgtsktivnrgirgyqtgl llenldahlyggavdkiflligtndigkdvpvnealnnleaiiqsvardyplteikllsilpvnereey qqavyirsnekiqnwnqayqelasaymqvefvpvfdcltdqagqlkkeyttdglhlsiagyqalskslk dyly
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.50 Rfree 0.19311
    Matthews' coefficent 2.10 Rfactor 0.15996
    Waters 1266 Solvent Content 41.43

    Ligand Information
    Ligands GOL (GLYCEROL) x 9
    Metals MG (MAGNESIUM) x 7

    Jmol

     
    Google Scholar output for 2hsj
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    3. Crystal structure of isoamyl acetate_hydrolyzing esterase from Saccharomyces cerevisiae reveals a novel active site architecture and the basis of substrate specificity
    J Ma, Q Lu, Y Yuan, H Ge, K Li, W Zhao - Proteins: Structure, , 2011 - Wiley Online Library
     
    4. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    5. An FPGA design for evaluating score function in protein energy calculation
    JM Romero-Ximil, A Diaz-Perez - Field Programmable Logic , 2009 - ieeexplore.ieee.org
     
    6. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch