.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hv2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved hypothetical protein from Enterococcus faecalis V583 at 2.4 A resolution. To be Published
    Site MCSG
    PDB Id 2hv2 Target Id APC28944
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5427,AAO80825, 226185 Molecular Weight 45365.22 Da.
    Residues 397 Isoelectric Point 5.76
    Sequence mttkrvkkmgkeemkemfdlviyafnqeptaerqerfekllshtqsygflideqltsqvmatpfqvnfh gvrypmagigyvasypeyrgeggisaimkemladlakqkvalsylapfsypfyrqygyeqtfeqaeyti ktedwprvkrvpgtikrvswadgkevikdvylenqrahsggviretwwldytlnraskpnnqaiyysse gkaegyviyriaagtfeivewnyltntafkalagfigshsgsvqsfhwingfagkdlndlmptpaasvk ilpymmarivelqtflekypfqsgeketysleiedsygpwnegiwtitideqgkatvtkgaaekegtaa lkadiqtwtqlflgyrsaetlsfyerlqgdatiaqrlgqrlvkgmpiledyf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.40 Rfree 0.23347
    Matthews' coefficent 2.70 Rfactor 0.18504
    Waters 546 Solvent Content 54.44

    Ligand Information
    Ligands EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 5;PG4 (TETRAETHYLENE) x 6
    Metals

    Jmol

     
    Google Scholar output for 2hv2
    1. Protein secondary structure predict based on the path with the maximum weight
    L Luo, Z Shao - Computing and Intelligent Systems, 2009. ICIS , 2009 - ieeexplore.ieee.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch