.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i00

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the acetyltransferase (GNAT family) from Enterococcus faecalis. To be Published 2006
    Site MCSG
    PDB Id 2i00 Target Id APC29390
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5447,AAO82078, 226185 Molecular Weight 48024.04 Da.
    Residues 406 Isoelectric Point 4.89
    Sequence mdeqefrkqltlkpveeehidqfnellsyvfqvteadieesgfenkrafikskqpilelskvfgwfhen qlisqiaiypcevnihgalykmggvtgvgtypeyanhglmkdliqtaleemrqdkqwisylfpynipyy rrkgweimsdklsfkirdtqlpktvpvpgmierlavdhpdvfdvyarfarqnhgalirsafnweeywrf eneeertaavyyganqeplgvlfywvadevfhikemfylnqearnglwnfitahfsmvywvkgdiykne plaflledsqikesiepyymarivdvkaflenfpfestakpfhfvvkdpvaewnngifgliwdendqvt itdeplgtavhldiqtltclvmnyrrpsylhrieridtdketlnslerifpdqeayfsdyf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.30 Rfree 0.26977
    Matthews' coefficent 2.47 Rfactor 0.21301
    Waters 376 Solvent Content 50.23

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2i00
    1. Mutual information and variants for protein domain-domain contact prediction
    M Gomes, R Hamer, G Reinert - BMC Research , 2012 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch