.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i0m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the phosphate transport system regulatory protein PhoU from Streptococcus pneumoniae. To be Published 2006
    Site MCSG
    PDB Id 2i0m Target Id APC80686
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5617,AAK76148, 170187 Molecular Weight 24190.49 Da.
    Residues 216 Isoelectric Point 4.74
    Sequence mrnqfdlelheleqsflglgqlvletaskallalaskdkemaeliinkdhainqgqsaieltcarllal qqpqvsdlrfvisimsscsdlermgdhmagiakavlqlkenqlapdeeqlhqmgklslsmladllvafp lhqaskaisiaqkdeqidqyyyalskeiiglmkdqetsipngtqylyiighlerfadyianicerlvyl etgelvdln
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.28624
    Matthews' coefficent 2.52 Rfactor 0.23493
    Waters 24 Solvent Content 51.28

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 3

    Jmol

     
    Google Scholar output for 2i0m
    1. Defining the Functional Domain of Programmed Cell Death 10 through Its Interactions with Phosphatidylinositol-3, 4, 5-Trisphosphate
    CF Dibble, JA Horst, MH Malone, K Park, B Temple - PLoS One, 2010 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch