.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i0z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a FAD binding protein from Bacillus cereus, a putative NAD(FAD)-utilizing dehydrogenases. To be Published
    Site MCSG
    PDB Id 2i0z Target Id APC25148
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5322,AAP11611, 226900 Molecular Weight 46168.65 Da.
    Residues 423 Isoelectric Point 8.21
    Sequence mhydvivigggpsglmaaigaaeeganvllldkgnklgrklaisgggrcnvtnrlpldeivkhipgngr flysafsifnnediitffenlgvklkeedpgrmfpvsnkaqsvvdalltrlkdlgvkirtntpvetiey engqtkavilqtgevletnhvviavggksvpqtgstgdgyawaekaghtitelfptevpilsnepfird rslqglalrdinlsvlnpkgkaiishkmdmlfthfglsgpaalrcsqfvvkalkkfktntiqmsidalp eenseqlfqrmlkqmkedpkkgiknvlkgyvperyflfllekneidgseqagqvshekiralvkdfkef tvnvngtqsiekafvtgggvsvkeinpkemsskftnglyfcgevldihgytggynitsalvtgriagtt agenakmqy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.84 Rfree 0.24794
    Matthews' coefficent 2.15 Rfactor 0.19516
    Waters 380 Solvent Content 42.67

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 1
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2i0z
    1. CASP9 target classification
    LN Kinch, S Shi, H Cheng, Q Cong, J Pei - Proteins: Structure, , 2011 - Wiley Online Library
     
    2. Evaluating the solution from MrBUMP and BALBES
    RM Keegan, F Long, VJ Fazio, MD Winn - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch