.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i1s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein MM_3350 from Methanosarcina mazei Go1. TO BE PUBLISHED
    Site MCSG
    PDB Id 2i1s Target Id APC86124
    Molecular Characteristics
    Source Methanosarcina mazei go1
    Alias Ids TPS5828,AAM33046.1, PF07929, 192952 Molecular Weight 21927.66 Da.
    Residues 188 Isoelectric Point 4.68
    Sequence mkktfekvyhlklsikgitpqiwrriqvpenytfldlhkaiqavmdwedyhlhefemvnpktgmldkig aegddfdafggplvsekkaklsdyftlenkealytydfgdnwqvkvrlekilprkegveypictagkra avpedsggvwgyeemlevlkdseheeyedtvlwlgddfdpeyfdpkdvsf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.24284
    Matthews' coefficent 3.47 Rfactor 0.192
    Waters 157 Solvent Content 64.60

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch