.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i45

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein NMB1881 from Neisseria meningitidis. To be Published
    Site MCSG
    PDB Id 2i45 Target Id APC83736
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS5710,AAF42215.1, 122586 Molecular Weight 11994.98 Da.
    Residues 107 Isoelectric Point 5.38
    Sequence mqnetinlkqhlaaikeywqpeiinrhgfqfhlvkllgdygwhthgysdkvlfavegdmavdfadggsm tiregemavvpksvshrprsengcslvlielsdpseav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.50 Rfree 0.26793
    Matthews' coefficent 2.87 Rfactor 0.19897
    Waters 243 Solvent Content 57.22

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch