.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i5r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure and putative function of small Toprim domain-containing protein from Bacillus stearothermophilus. Proteins 70 311-319 2007
    Site MCSG
    PDB Id 2i5r Target Id APC35832
    Related PDB Ids 2fcj 
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5514,RBSTP2199, 1422 Molecular Weight 13696.98 Da.
    Residues 119 Isoelectric Point 5.51
    Sequence mrrvekviivegrsdkqkvaavlnepvvivctngtisdarleeladelegydvylladadeageklrrq frrmfpeaehlyidrayrevaaapiwhlaqvllrarfdvrieslmrgrge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.65 Rfree 0.20799
    Matthews' coefficent 1.86 Rfactor 0.17135
    Waters 211 Solvent Content 33.85

    Ligand Information
    Ligands GOL (GLYCEROL) x 6;SO4 (SULFATE) x 2;MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 1
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2i5r
    1. Crystal structure and putative function of small Toprim domain_containing protein from Bacillus stearothermophilus
    P _ez_ov, D Borek, SF Moy - Proteins: Structure, , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    2fcj.png
    No description
    27.21 kB22:12, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch