.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i5u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.5 A crystal structure of a DnaD domain protein from Enterococcus Faecalis. To be Published 2006
    Site MCSG
    PDB Id 2i5u Target Id APC85179
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5765,AAO82531.1, PF04271, 226185 Molecular Weight 9307.93 Da.
    Residues 80 Isoelectric Point 4.73
    Sequence irsiwenngfglmssktmtdfdywisdfekigasqkeaeqlivkaieiaidanarnynyinailkdweq rgfksveerea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.22702
    Matthews' coefficent 2.02 Rfactor 0.17957
    Waters 94 Solvent Content 38.98

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2i5u
    1. Molecular replacement using ab initio polyalanine models generated with ROSETTA
    DJ Rigden, RM Keegan, MD Winn - Acta Crystallographica Section D , 2008 - scripts.iucr.org
     
    2. When simple sequence comparison fails: the cryptic case of the shared domains of the bacterial replication initiation proteins DnaB and DnaD
    FY Marston, WH Grainger, WK Smits - Nucleic acids , 2010 - Oxford Univ Press
     
    3. The cyanobacterial cell division factor Ftn6 contains an N-terminal DnaD-like domain
    M Marbouty, C Saguez, F Chauvat - BMC structural biology, 2009 - biomedcentral.com
     
    4. The chromosomal replication initiation machinery of low G+ C content firmicutes
    GS Briggs, WK Smits, P Soultanas - Journal of Bacteriology, 2012 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch