.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i6d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a putative RNA methyltransferase of the TrmH family from Porphyromonas gingivalis. TO BE PUBLISHED
    Site MCSG
    PDB Id 2i6d Target Id APC80860
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS5627,AAQ65912.1, 242619 Molecular Weight 27803.54 Da.
    Residues 254 Isoelectric Point 6.34
    Sequence mlsanqikflrslrerkyrlreqafavegpklvgemlpfyrcrmlvgtaamlravstphdaevvelpes fdfkristqttpqplmavfdlpaepepvvegltllldgvqdpgnvgtilrtadwfgirhvwlgtgsadv fspkvvqasmgalarvqptplkntvdtlayfrrqgipvygafldgqslyeaplpnftepailvlgsegr gispevaaeitdrltipasglsvkghteslnvaiatailcsewrrrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.2347
    Matthews' coefficent 2.38 Rfactor 0.18892
    Waters 315 Solvent Content 48.28

    Ligand Information
    Ligands ACY (ACETIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 2i6d
    1. Protein knots and fold complexity: Some new twists
    WR Taylor - Computational biology and chemistry, 2007 - Elsevier
     
    2. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    3. Characterizing the existing and potential structural space of proteins by large-scale multiple loop permutations
    L Dai, Y Zhou - Journal of molecular biology, 2011 - Elsevier
     
    4. Crystal structure of Mj1640/DUF358 protein reveals a putative SPOUT-class RNA methyltransferase
    HY Chen, YA Yuan - Journal of Molecular Cell Biology, 2010 - jmcb.oxfordjournals.org
     
    5. Crystal structure of the methyltransferase domain of human TARBP1
    H Wu, J Min, H Zeng - : Structure, Function, and , 2008 - Wiley Online Library
     
    6. Crystal Structure of the Nosiheptide-Resistance Methyltransferase of Streptomyces actuosus
    H Yang, Z Wang, Y Shen, P Wang, X Jia, L Zhao - Biochemistry, 2010 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch