The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of hypothetical protein Atu0120 from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2i6h Target Id APC5905
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4916,NP_530829.1, 176299 Molecular Weight 21079.32 Da.
    Residues 183 Isoelectric Point 5.41
    Sequence mkndtaalaadivdfwkkagpdkwfdkdaafdnhfhdrfrdahfaaarreldgwlegaesslalmllld qfprncfrgtahmyatdplarffadeairrghdqavsedlrvffylpfshaediaaqqracdlnqplgg lylhhaeehrdiverfgrfphrngillrettpeerqyleeggfsg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.75 Rfree 0.1992
    Matthews' coefficent 2.16 Rfactor 0.166
    Waters 456 Solvent Content 42.94

    Ligand Information
    Metals CL (CHLORIDE) x 3;CA (CALCIUM) x 3


    Google Scholar output for 2i6h
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch