.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i6x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a predicted HAD-like family hydrolase from Porphyromonas gingivalis. (CASP Target). To be Published
    Site MCSG
    PDB Id 2i6x Target Id APC80854
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS5626,AAQ65895.1, 242619 Molecular Weight 24030.04 Da.
    Residues 208 Isoelectric Point 4.71
    Sequence mirnivfdlggvlihlnreesirrfkaigvadieemldpylqkglfldlesgrkseeefrtelsryigk eltyqqvydallgfleeisaekfdyidslrpdyrlfllsntnpyvldlamsprflpsgrtldsffdkvy ascqmgkykpnediflemiadsgmkpeetlfiddgpanvataerlgfhtycpdngenwipaitrllreqk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.27583
    Matthews' coefficent 2.54 Rfactor 0.20948
    Waters 110 Solvent Content 51.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2i6x
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch