.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i7h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Nitroreductase-like Family Protein from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 2i7h Target Id APC24638
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5299,AAP07777, 226900 Molecular Weight 21305.35 Da.
    Residues 186 Isoelectric Point 8.39
    Sequence mttytsianvikerrsvrtftdkavekdlliellndatwapnhkhrepwncklyigegrkklvdavlns fteeerakrgkilsdrflstpaqivvymnedprqiqrdedyaatcafmqnfqllawerglgcvwksggl nynplfiegigltrgqrivgilhigyfdkapegkartpitekmeiieg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.30 Rfree 0.21254
    Matthews' coefficent 3.20 Rfactor 0.17168
    Waters 898 Solvent Content 61.56

    Ligand Information
    Ligands FMN (FLAVIN) x 4;SO4 (SULFATE) x 7
    Metals

    Jmol

     
    Google Scholar output for 2i7h
    1. Crystallization and preliminary X-ray diffraction analysis of ydjA, a minimal nitroreductase from Escherichia coli K12
    JW Choi, J Lee, N Kosuke, CH Jung - Section F: Structural , 2007 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch