The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title conserved domain protein. To be Published
    Site MCSG
    PDB Id 2i7r Target Id APC80326
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5596,AAK74872, 170187 Molecular Weight 12888.09 Da.
    Residues 115 Isoelectric Point 4.79
    Sequence mnlnqldiivsnvpqvcadlehildkkadyandgfaqftigshclmlsqnhlvplenfqsgiiihieve dvdqnykrlnelgikvlhgptvtdwgtesllvqgpaglvldfyrmk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.257
    Matthews' coefficent 2.85 Rfactor 0.198
    Waters 87 Solvent Content 56.82

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch