.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i8g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein DIP2269 from Corynebacterium diphtheriae. To be Published
    Site MCSG
    PDB Id 2i8g Target Id APC82926
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS5694,CAE50793.1, 1717 Molecular Weight 16197.28 Da.
    Residues 148 Isoelectric Point 4.42
    Sequence mvhdsalpfdalpmppqgregfeecpyldsqwvadtngqrmtgqgvdtrfdtpacvfwsypeapqatvm vrhmpseeeairvvdwaapidttepaeepdgwsggragheegavyavqkgpvavvvwsnqqqslkaelm akeaiarlgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.74 Rfree 0.2299
    Matthews' coefficent 1.89 Rfactor 0.1798
    Waters 263 Solvent Content 34.84

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 2
    Metals

    Jmol

     
    Google Scholar output for 2i8g
    1. The structure of RseB: a sensor in periplasmic stress response of E. coli
    P Wollmann, K Zeth - Journal of molecular biology, 2007 - Elsevier
     
    2. The Structure of RseB, a Sensor for Periplasmic Stress in Escherichia coli
    P Wollmann - 2008 - edoc.ub.uni-muenchen.de
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch