.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i9d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title chloramphenicol acetyltransferase. To be Published
    Site MCSG
    PDB Id 2i9d Target Id APC81922
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS5675,AAO78225.1, 226186 Molecular Weight 24707.66 Da.
    Residues 214 Isoelectric Point 5.51
    Sequence mkqiidienwerkenfnffrhfqnpqlsitsevecggarqrakaagqsfflhylyavlraaneipefry ridpdgrvvlydtidmlspikikengkffttrfpyhndfdtfyqearliidaipedgdpyaaeneevad gdyglillsatpdlyftsitgtqekrsgnnypllnagkaiiregrlvmpiamtihhgfidghhlslfyk kvedflk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.23
    Matthews' coefficent 3.37 Rfactor 0.188
    Waters 216 Solvent Content 63.49

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2i9d
    1. Beta-Strand Interfaces of Non-Dimeric Protein Oligomers Are Characterized by Scattered Charged Residue Patterns
    G Feverati, M Achoch, J Zrimi, L Vuillon, C Lesieur - PloS one, 2012 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch