.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i9x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of SpoVG from Staphylococcus epidermidis ATCC 12228. To be Published
    Site MCSG
    PDB Id 2i9x Target Id APC86317.1
    Molecular Characteristics
    Source Staphylococcus epidermidis atcc 12228
    Alias Ids TPS5844,AAO05927.1, PF04026, 176280 Molecular Weight 9575.48 Da.
    Residues 84 Isoelectric Point 5.28
    Sequence mkvtdvrlrkiqtdgrmkalvsitldeafvihdlrviegnsglfvampskrtpdgefrdiahpinsdmr qeiqdavmkvydetd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.2226
    Matthews' coefficent 2.52 Rfactor 0.18806
    Waters 155 Solvent Content 51.18

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 5
    Metals

    Jmol

     
    Google Scholar output for 2i9x
    1. Expression, crystallization, and preliminary X-ray crystallographic analysis of putative SpoVG from Staphylococcus aureus
    HH Kim, BJ Lee, AR Kwon - Archives of pharmacal research, 2010 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch