.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ia9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of SpoVG from Bacillus subtilis subsp. subtilis str. 168. To be Published
    Site MCSG
    PDB Id 2ia9 Target Id APC85465
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS5771,CAB11825.1, PF04026, 224308 Molecular Weight 10892.58 Da.
    Residues 97 Isoelectric Point 5.25
    Sequence mevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskrtpdgefrdithpinsstr gkiqdavlneyhrlgdtealefeeagas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.00 Rfree 0.296
    Matthews' coefficent 3.79 Rfactor 0.22671
    Waters 98 Solvent Content 67.50

    Ligand Information
    Ligands SO4 (SULFATE) x 3;PEG (DI(HYDROXYETHYL)ETHER) x 5
    Metals

    Jmol

     
    Google Scholar output for 2ia9
    1. Expression, crystallization, and preliminary X-ray crystallographic analysis of putative SpoVG from Staphylococcus aureus
    HH Kim, BJ Lee, AR Kwon - Archives of pharmacal research, 2010 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch