.
The Open Protein Structure Annotation Network
PDB Keyword
.

2iaf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a fragment (residues 11 to 161) of L-serine dehydratase from Legionella pneumophila. To be Published
    Site MCSG
    PDB Id 2iaf Target Id APC86037.3
    Related PDB Ids 2iqq 
    Molecular Characteristics
    Source Legionella pneumophila subsp. pneumophila str. philadelphia 1
    Alias Ids TPS5811,AAU26879.1, PF03315, 272624 Molecular Weight 16275.65 Da.
    Residues 148 Isoelectric Point 5.48
    Sequence gpssshtvgpmlaanaflqlleqknlfdktqrvkvelygslaltgkghgtdkailnglenkapetvdpa smiprmheildsnllnlagkkeipfheatdflflqkellpkhsngmrfsafdgnanllieqvyysiggg fitteedfdk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.22418
    Matthews' coefficent 3.52 Rfactor 0.19455
    Waters 87 Solvent Content 65.02

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2iaf
    1. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    2iqq.png
    No description
    27.45 kB22:13, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch