The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of SCO3833, a member of the TetR transcriptional regulator family from Streptomyces coelicolor A3. To be Published
    Site MCSG
    PDB Id 2iai Target Id APC6217
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5038,NP_628021.1, 100226 Molecular Weight 23098.99 Da.
    Residues 209 Isoelectric Point 6.25
    Sequence mttakrdtytpetllsvavqvfiergydgtsmehlskaagiskssiyhhvtgkeellrravsraldelf gildeeharvgtaaerleyvvrrmvevlmaelpyvtlllrvrgntgterwalerrrefdhrvaallkda aaegdvradvevrlatrlvfgminsivewyrpegpdgrsdasgasgvsgagerevvdavarlvfgglrkas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.2082
    Matthews' coefficent 2.39 Rfactor 0.1685
    Waters 289 Solvent Content 48.52

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch