.
The Open Protein Structure Annotation Network
PDB Keyword
.

2igs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hypothetical Protein from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 2igs Target Id APC5561
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS20321,NP_250912, 208964 Molecular Weight 23439.46 Da.
    Residues 215 Isoelectric Point 5.21
    Sequence maeiniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdiskadqqystllaq eiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldrfkgspnvyptdvgfstdasg gisqesgllvsygvnlrtltpgtwqamtlpedikalvgpgvglrldapnfsdvfntiksglryttavtl llayfaai
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.17 Rfree 0.25017
    Matthews' coefficent 2.77 Rfactor 0.18728
    Waters 1059 Solvent Content 55.60

    Ligand Information
    Ligands SO4 (SULFATE) x 13;ACY (ACETIC) x 8;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2igs
    1. Structural determinants stabilizing helical distortions related to proline
    J Rey, J Deville, M Chabbert - Journal of structural biology, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch