.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ijc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a Conserved Hypothetical Protein PA0269 from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 2ijc Target Id APC22132
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS5211,AAG03658, 208964 Molecular Weight 16201.64 Da.
    Residues 145 Isoelectric Point 5.43
    Sequence mttrlewakaspdayaamlglekalakaglerplielvylrtsqingcaycvnmhandarkageteqrl qalcvwqetpyftpreraalawteqlarlsqgalphglldelrehfddkeiaeltlavsainawnrfgv gmgmqpe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 9
    Resolution (Å) 2.05 Rfree 0.2534
    Matthews' coefficent 2.26 Rfactor 0.19024
    Waters 833 Solvent Content 45.54

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ijc
    1. Crystal structure of alkyl hydroperoxidase D like protein PA0269 from Pseudomonas aeruginosa: Homology of the AhpD-like structural family
    T Clarke, V Romanov, Y Chirgadze - BMC structural , 2011 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch