.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ijl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a putative ModE from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2ijl Target Id APC5907
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4918,NP_533229.1, 176299 Molecular Weight 14800.21 Da.
    Residues 131 Isoelectric Point 6.75
    Sequence msekrlplkpvlridfppgerlghgkvelmqliaetgsisaagramdmsyrrawllvdalnhmfrqpvi csqrggkqgggaaltvfgaelleryrgmeermnealredidwleanrnpqdalnrdrepptl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.23623
    Matthews' coefficent 2.20 Rfactor 0.17374
    Waters 106 Solvent Content 44.13

    Ligand Information
    Ligands SO4 (SULFATE) x 8;EDO (1,2-ETHANEDIOL) x 6
    Metals

    Jmol

     
    Google Scholar output for 2ijl
    1. Expression, purification, crystallization and preliminary X-ray analysis of the DNA-binding domain of Rhodobacter capsulatus MopB
    A Muller, C Schlicker, M Fehringer - Section F: Structural , 2011 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch