.
The Open Protein Structure Annotation Network
PDB Keyword
.

2il5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of hypothetical protein SA2116 from Staphylococcus aureus. To be Published
    Site MCSG
    PDB Id 2il5 Target Id APC23650
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus n315
    Alias Ids TPS5274,NP_375438, 158879 Molecular Weight 20082.02 Da.
    Residues 168 Isoelectric Point 5.26
    Sequence makfnvenehveveieklykfspelvyeawtkkdllkqwfmtsartnkeieadvkeggkyrivdqqrng kvnviegiyeslvmdeyvkmtigmpglsetqdvievefferetggtqmlfyyrslvekerrftnleykq kkkeyhdamvhgfelmfdkmyhvietstqq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.2452
    Matthews' coefficent 3.14 Rfactor 0.2015
    Waters 82 Solvent Content 60.83

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2il5
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Prediction and confirmation of norcoclaurine synthase activity
    C Harrison, UCL CoMPLEX - 2010 - ucl.ac.uk
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch