.
The Open Protein Structure Annotation Network
PDB Keyword
.

2iqq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of Iron, Sulfur-Dependent L-serine dehydratase from Legionella pneumophila subsp. pneumophila. To be Published
    Site MCSG
    PDB Id 2iqq Target Id APC86037.3
    Related PDB Ids 2iaf 
    Molecular Characteristics
    Source Legionella pneumophila subsp. pneumophila str. philadelphia 1
    Alias Ids TPS5810,AAU26879.1, PF03315, 272624 Molecular Weight 16275.65 Da.
    Residues 148 Isoelectric Point 5.48
    Sequence gpssshtvgpmlaanaflqlleqknlfdktqrvkvelygslaltgkghgtdkailnglenkapetvdpa smiprmheildsnllnlagkkeipfheatdflflqkellpkhsngmrfsafdgnanllieqvyysiggg fitteedfdk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.66 Rfree 0.2259
    Matthews' coefficent 3.24 Rfactor 0.17435
    Waters 63 Solvent Content 62.01

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2iqq
    1. Structures of three members of Pfam PF02663 (FmdE) implicated in microbial methanogenesis reveal a conserved+ core domain and an auxiliary C-terminal treble-
    HL Axelrod, D Das, P Abdubek, T Astakhova - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Kinetic, Mutagenic, and Structural Homology Analysis of L-Serine Dehydratase from Legionella pneumophila
    XL Xu, S Chen, GA Grant - Archives of Biochemistry and Biophysics, 2011 - Elsevier
     
    3. Contrasting Catalytic and Allosteric Mechanisms for Phosphoglycerate Dehydrogenases
    GA Grant - Archives of Biochemistry and Biophysics, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch