.
The Open Protein Structure Annotation Network
PDB Keyword
.

2iqt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Fructose-Bisphosphate Aldolase, Class I from Porphyromonas gingivalis. To be Published
    Site MCSG
    PDB Id 2iqt Target Id APC81103
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS5640,AAQ66757.1, 242619 Molecular Weight 32985.46 Da.
    Residues 293 Isoelectric Point 5.62
    Sequence mnkeqlqqmrqapgfvgaldqsggstpkalkaygiqpdayqseeemfdlihqmrtrmitspafatgkii gvilfertmrgkiegmptadflwekrhivpflkvdkglqdeangvqlmkpfpelgklceeavgyhvfgt kmrsvikqaneqgirdiveqqfqwgkeilshglvpilepevdihcpekakaeeilkrellaqldkmtep vmlkitiptvdnfykeiiehpmmlrvvalsggysreqanellsrnhgviasfsralveglsarqtdaef namleasiedvyqasik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.46 Rfree 0.23172
    Matthews' coefficent 3.09 Rfactor 0.18167
    Waters 128 Solvent Content 60.24

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2iqt
    1. Preparation and Characterization of a Bifunctional Aldolase/Kinase Enzyme: A More Efficient Biocatalyst for C C Bond Formation
    L Iturrate, I Snchez_Moreno - -A European Journal, 2010 - Wiley Online Library
     
    2. Preparation and characterization of a bifunctional aldolase/kinase enzyme. A more efficient biocatalyst for CC bond formation
    L Iturrate Montoya, I Snchez-Moreno, I Oroz-Guinea - 2010 - handle.digital.csic.es
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch