The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides. To be Published
    Site MCSG
    PDB Id 2is5 Target Id APC83859.1
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS5718,AAF41413.1, PF05838, 122586 Molecular Weight 18318.65 Da.
    Residues 164 Isoelectric Point 9.51
    Sequence sdkfnqfinrvlsheggyanhpkdpggetnwgitkrtaqangyngsmramtreqaisiyrkafweryra dqmpeavafqffdacvnhgygnaarmlqraagvpddgvigavslkainslpendlllrfnaerlvfytk lgtftsfgkgwvrrvaqnlihasadn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.22877
    Matthews' coefficent 2.22 Rfactor 0.19665
    Waters 413 Solvent Content 44.48

    Ligand Information
    Ligands CIT (CITRIC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch