.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nn5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of conserved hypothetical protein EF_2215 from Enterococcus faecalis. To be Published
    Site MCSG
    PDB Id 2nn5 Target Id APC29336
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5443,AAO81946, 226185 Molecular Weight 18836.30 Da.
    Residues 160 Isoelectric Point 4.63
    Sequence mkdtfrlenqtiyfgteraisaspqtiwryltetdklkqwfpeleigelgvngfwrfilpdfeetmpft dyaeekylgvtwdtgiiyfdlkeqaphqtllvfseslpenfttprhkdiagwsivlnrlkqvvetpdaa pekidfpqienhylekltnlen
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.45 Rfree 0.1932
    Matthews' coefficent 2.00 Rfactor 0.1502
    Waters 231 Solvent Content 38.63

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 2
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2nn5
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch