.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nnn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of probable transcriptional regulator from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 2nnn Target Id APC6074
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4996,NP_250294.1, 208964 Molecular Weight 15200.54 Da.
    Residues 140 Isoelectric Point 9.98
    Sequence msrttpyrlddqigfilrqanqryaalfangigngltptqwaalvrlgetgpcpqnqlgrltamdaati kgvverldkrgliqrsadpddgrrllvslspagraeleaglaaareinrqalaplslqeqetlrgllar li
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 2.40 Rfree 0.26222
    Matthews' coefficent 3.27 Rfactor 0.21834
    Waters 482 Solvent Content 62.38

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2nnn
    1. Crystal structure of the MarR family regulatory protein, ST1710, from Sulfolobus tokodaii strain 7
    T Kumarevel, T Tanaka, M Nishio, SCB Gopinath - Journal of structural , 2008 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch