.
The Open Protein Structure Annotation Network
PDB Keyword
.

2np3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TetR-family regulator (SCO0857) from Streptomyces coelicolor A3. To be Published
    Site MCSG
    PDB Id 2np3 Target Id APC6214
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5037,NP_625157.1, 100226 Molecular Weight 22321.15 Da.
    Residues 212 Isoelectric Point 8.97
    Sequence mtgqaagpaagpaagqatkhaggrrpgetrtreailtaarvcfaergfdatslrriaetagvdqslvhh fygtkenlflqalelpgkieeaitaaaqggldgigervvrahlsvwddvssrpalmtmvrsaaihraaa arlretatgilaralggvitgedamlrtsmvatqlvglammryvahleplasadtdtvarhygravqai vtdrd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.35 Rfree 0.26428
    Matthews' coefficent 2.28 Rfactor 0.22237
    Waters 27 Solvent Content 45.99

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch