.
The Open Protein Structure Annotation Network
PDB Keyword
.

2npn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of cobalamin synthesis related protein (CobF) from Corynebacterium diphtheriae. To be Published
    Site MCSG
    PDB Id 2npn Target Id APC82580
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS5683,CAE49338.1, 1717 Molecular Weight 28242.59 Da.
    Residues 250 Isoelectric Point 5.66
    Sequence mrtiyvigigtgspefltlqaisglrhaqaivaldkgeqksdllalrqkivdthapgtpiyavtdperd rnpdnyeeevrrwhaerahllastirertpddgavaflvwgdpslydstlriiehmrnledlhadvkvi pgitavqvltaehgilinrigeaihittgrnlpetsakdrrncvvmldgktawqdvatehtymwwgafl gteqqvlrkgyvheigaqvaelkqqlrtehgwimdtyllreld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.19776
    Matthews' coefficent 2.10 Rfactor 0.17197
    Waters 213 Solvent Content 41.36

    Ligand Information
    Ligands SAM (S-ADENOSYLMETHIONINE) x 1;GOL (GLYCEROL) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2npn
    1. Cloning, purification and preliminary crystallographic analysis of cobalamin methyltransferases from Rhodobacter capsulatus
    A Seyedarabi, T Hutchison, TT To, E Deery - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch